PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26921-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 212aa    MW: 22913.1 Da    PI: 9.7492
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26921-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.33.1e-093382554
                     HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     ++  E+ RR+r+N   ++L +l+Pk  ++++  ++    L  A  YIk+L
  TRIUR3_26921-P1 33 KKDSEKERRQRMNGLCDKLASLIPKEHNPHADTMTQLGSLDVAASYIKML 82
                     5778*********************75777777***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.5442882IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.26E-63386No hitNo description
Gene3DG3DSA:4.10.280.101.1E-113397IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.4E-73382IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003537.0E-63488IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.31E-1035100IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAVTAKPARG GKRTRASSGA AGATATTAVL TEKKDSEKER RQRMNGLCDK LASLIPKEHN  60
PHADTMTQLG SLDVAASYIK MLKERVDELQ HKKTSAQAMA TLQGVSGISI PSTTSSGAGS  120
PEREKYLEAS APVVQVRRTD DSSMEVRMIC STEKPIKLHE VITILEEEGA DIINANHSVV  180
GHKIFYTIHF RAFSNRIGID DSRISGRLGA LV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565225.13e-67PREDICTED: uncharacterized protein LOC100830809
TrEMBLM7XLV91e-155M7XLV9_TRIUA; Uncharacterized protein
STRINGMLOC_17549.11e-101(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82936133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G10585.19e-15bHLH family protein